DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AgaP_AGAP011092

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_309558.3 Gene:AgaP_AGAP011092 / 1270836 VectorBaseID:AGAP011092 Length:634 Species:Anopheles gambiae


Alignment Length:426 Identity:107/426 - (25%)
Similarity:160/426 - (37%) Gaps:114/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGI 181
            ||:.|....:|:|:..|..:|...|||.:.|:|.  |.|.|.|:.||.|....|::.|::.|||.
Mosquito   183 TNVYVKNFGEDLTEEALRDMFEKFGPITSHRVMT--KDGKSRGFGFVAFEKPEDAEEAVQKLNGK 245

  Fly   182 TVRN-KRLKVSYARPGGESIKD------------------TNLYVTNLPRTITDDQLDTIFGKYG 227
            .:.: |.|.|..|:...|...:                  .||||.||..||.|::|...|..||
Mosquito   246 ELSDGKVLYVGRAQKKNERQMELKRRFEQLKMERLTRYHGVNLYVKNLDDTIDDERLRKEFAPYG 310

  Fly   228 SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHF 292
            :|....::.|:  ||.:|..||.::..:||.:|::.:|..|.  ||:||.|.||:...:.| :|.
Mosquito   311 TITSAKVMLDE--GRSKGFGFVCFSAPDEATKAVTEMNGRIV--GSKPLYVALAQRKEERK-SHL 370

  Fly   293 MSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLY 357
            .||.               .....:..|.|                              :..:|
Mosquito   371 ASQY---------------IQRVNSLRMQH------------------------------IGQVY 390

  Fly   358 RR--KYHYPYLXLTPQQQQQLLQHQQQALGFTS---SSNNSIGNGNGNDN-----------NMLL 406
            ::  .|..|.:.     |.|.....|.|...|:   |:|..:....||.|           .|..
Mosquito   391 QQSGSYFMPTIA-----QPQRFYGPQVAPVRTAPRWSANAQMRPNAGNQNVAANAPAGGYPAMTA 450

  Fly   407 YH---QQYHQQQTQQQRLGNV-AAHNISPNGSNNNINTSNTNNINFNTIRQNGVAALHYLQEQLQ 467
            .|   .||.|       .||| .|:..:||..:...|::...|.......|...|.:.......|
Mosquito   451 AHVANNQYRQ-------AGNVRGANQQAPNAQSAQANSAAMRNAARPITGQQTAANMQTRPVAPQ 508

  Fly   468 LQQPQDQ-------QS----QQQQPLTMPSSPPFQQ 492
            |...|.:       ||    |..||:.:|:.|..||
Mosquito   509 LAAGQARTPNYKFTQSMRNPQVPQPVPIPAQPVAQQ 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 28/80 (35%)
RRM2_Hu_like 203..281 CDD:240822 30/77 (39%)
AgaP_AGAP011092XP_309558.3 PABP-1234 2..624 CDD:130689 107/426 (25%)
RRM1_I_PABPs 3..82 CDD:240824
RRM2_I_PABPs 88..164 CDD:240825
RRM3_I_PABPs 182..261 CDD:240826 28/79 (35%)
RRM4_I_PABPs 285..362 CDD:240827 32/80 (40%)
PABP 556..623 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.