DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and MSI2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_005257071.1 Gene:MSI2 / 124540 HGNCID:18585 Length:346 Species:Homo sapiens


Alignment Length:249 Identity:58/249 - (23%)
Similarity:94/249 - (37%) Gaps:35/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDF 165
            ||.|:....||.:.....:.:..|....:...|...|...|.|..|.:|||..|..|.|:.||.|
Human     5 GSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTF 69

  Fly   166 TSEMDSQRAIKVL----NGITVRNKRLKVSYARPGGESI--KDTNLYVTNLPRTITDDQLDTIFG 224
            .   |.....|||    :.:..:....||::.|.....:  :...::|..|......:.:...|.
Human    70 A---DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFE 131

  Fly   225 KYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL------NNVIPEGGSQPLSVRLAE- 282
            ::|.:....::.||.|.|.||..||.: :.|:..|.:..:      |.::....:||..|.... 
Human   132 QFGKVEDAMLMFDKTTNRHRGFGFVTF-ENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPG 195

  Fly   283 EHGKAKAA-----HFMSQMGVV-------------PANVPPPPPQPPAHMAAAF 318
            ..|:|:..     .||..||::             |...|....|.|...|||:
Human   196 TRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/83 (27%)
RRM2_Hu_like 203..281 CDD:240822 18/83 (22%)
MSI2XP_005257071.1 RRM1_MSI2 17..109 CDD:410153 22/94 (23%)
PABP-1234 <35..343 CDD:130689 52/219 (24%)
RRM2_MSI 111..184 CDD:240769 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.