DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and hnrnpa3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_031748359.1 Gene:hnrnpa3 / 100144993 XenbaseID:XB-GENE-5878765 Length:385 Species:Xenopus tropicalis


Alignment Length:226 Identity:59/226 - (26%)
Similarity:96/226 - (42%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMN 110
            :|.|||||              :.|.|....|...|.:|..|.::...:          :||..:
 Frog    44 AFSSSSSR--------------SAGEAAAPFGRERCAMPRGAMDDHWPS----------TDDQGH 84

  Fly   111 DPRASN--TNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFT--SEMD- 170
            :|:...  ..|.:..|..:.||..|...|...|.:..|.:|||.:|..|.|:.||.::  .|:| 
 Frog    85 EPKEPEQLRKLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDA 149

  Fly   171 --SQRAIKVLNGITVRNKRL--KVSYARPGGE-SIKDTNLYVTNLPRTITDDQLDTIFGKYGSIV 230
              |.|..|| :|..|..||.  :...||||.. ::|  .::|..:.....:..|...|..||.|.
 Frog   150 AMSARPHKV-DGRVVEPKRAVSREDSARPGAHLTVK--KIFVGGIKEDTEEYHLRDYFQSYGKIE 211

  Fly   231 QKNILRDKLTGRPRGVAFVRYNKREEAQEAI 261
            ...::.|:.:|:.||.|||.::..:...:.:
 Frog   212 TIEVMEDRQSGKKRGFAFVTFDDHDTVDKIV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 29/86 (34%)
RRM2_Hu_like 203..281 CDD:240822 13/59 (22%)
hnrnpa3XP_031748359.1 RRM1_hnRNPA_like 94..171 CDD:409992 26/77 (34%)
RRM2_hnRNPA3 184..263 CDD:409996 14/61 (23%)
HnRNPA1 328..>344 CDD:402981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.