DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and zcrb1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001107973.1 Gene:zcrb1 / 100135752 XenbaseID:XB-GENE-999756 Length:215 Species:Xenopus tropicalis


Alignment Length:92 Identity:34/92 - (36%)
Similarity:57/92 - (61%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEA 260
            ||.:...:.:||:|||.::|::.|..||.|||.:|:..||:||.:.|.:|||||.:..:|.:|..
 Frog     3 GGLAPSKSTVYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRRSKGVAFVLFLDKESSQNC 67

  Fly   261 ISALNNVIPEGGSQPLSVRLAEEHGKA 287
            :..|||....|  :.:...:|.::|:|
 Frog    68 VRGLNNKQLFG--RAIKASIAIDNGRA 92

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity