DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and LTP1

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_015398.1 Gene:LTP1 / 856187 SGDID:S000006277 Length:161 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:60/153 - (39%)
Similarity:93/153 - (60%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLMICLGNICRSPIAEVVMVDTLEKANVKD--VEVDSAAIGGWHVGNRADPRAISTLQKHGLKCT 67
            |..|||||.||||:||.:....:||||:::  .::||.....:|||...|.|.:|..::||:|..
Yeast    10 VAFICLGNFCRSPMAEAIFKHEVEKANLENRFNKIDSFGTSNYHVGESPDHRTVSICKQHGVKIN 74

  Fly    68 HIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAPKGSKAELLMLGDFGLE--KKNRIIEDPYYERG 130
            |..:||:.:.|.|:|||.||||.|::.|:::.|:||||::.:.||:...  ....|||||:| ..
Yeast    75 HKGKQIKTKHFDEYDYIIGMDESNINNLKKIQPEGSKAKVCLFGDWNTNDGTVQTIIEDPWY-GD 138

  Fly   131 AEGFETAYQQCVVACAAFMKERL 153
            .:.||..::|.......|:|:.|
Yeast   139 IQDFEYNFKQITYFSKQFLKKEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 58/148 (39%)
LTP1NP_015398.1 LMWP 9..158 CDD:319970 58/148 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346437
Domainoid 1 1.000 114 1.000 Domainoid score I1325
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I1322
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62674
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm46666
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - LDO PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.