DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and AT3G44620

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001190010.1 Gene:AT3G44620 / 823588 AraportID:AT3G44620 Length:262 Species:Arabidopsis thaliana


Alignment Length:178 Identity:59/178 - (33%)
Similarity:83/178 - (46%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLMICLGNICRSPIAEVVMVDTLEKANV-KDVEVDSAAIGGWHVGNRADPRAISTLQKHGLKCTH 68
            ||.:|||||||||.||.|..|.::|..: ....:|||....:|.||.||||..|..::.|::.|.
plant    79 VLFVCLGNICRSPAAEGVFRDIVKKRGLDSKFNIDSAGTIDYHEGNMADPRMRSAAKRRGIEITS 143

  Fly    69 IVRQIRKQDFSEFDYIFGMDEDNMSELRR----------LAPKGSK----------AELLMLGDF 113
            :.|.|:..||.|||.|..||:.|..::.:          ..|...|          .||.::..|
plant   144 LSRPIKASDFREFDLILAMDDQNKEDILKAYNVWKARGNFPPDADKKVPLVCVCWTLELYLVDRF 208

  Fly   114 GLE----------KK--NRIIEDPYYERGAEGFETAYQQCVVACAAFM 149
            .|.          ||  ::.:.|||| .||:|||........||.:.:
plant   209 SLNFQVKLMCSYCKKHNDKFVPDPYY-GGAQGFEKVLDLLEDACESLL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 59/178 (33%)
AT3G44620NP_001190010.1 LMWPc 77..256 CDD:238063 59/178 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 85 1.000 Domainoid score I2819
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2255
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm3520
orthoMCL 1 0.900 - - OOG6_101411
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.