DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and acp1

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001005082.1 Gene:acp1 / 448657 XenbaseID:XB-GENE-973004 Length:157 Species:Xenopus tropicalis


Alignment Length:154 Identity:71/154 - (46%)
Similarity:97/154 - (62%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKVLMICLGNICRSPIAEVVMVDTLEKANV-KDVEVDSAAIGGWHVGNRADPRAISTLQKHGLKC 66
            :.||.:||||||||||||.|....:..|.. |:..:||||...|:||:..|.||:..|:.||::.
 Frog     7 KSVLFVCLGNICRSPIAEAVFRKLVTDAGTSKEWSIDSAATSDWNVGSSPDSRALKCLKSHGIET 71

  Fly    67 THIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAPKG-----SKAELLMLGDFGLEKKNRIIEDPY 126
            .|..:||.:.||..:|||..|||.|:.:|:|   ||     |||::.:||.:..:|| .||||||
 Frog    72 AHRAQQITRDDFLSYDYILCMDESNLRDLKR---KGSQVQNSKAKIELLGSYDPQKK-LIIEDPY 132

  Fly   127 YERGAEGFETAYQQCVVACAAFMK 150
            |.|. |.|||.||||:..|.:|::
 Frog   133 YGRD-EDFETVYQQCIRCCKSFLE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 71/152 (47%)
acp1NP_001005082.1 LMWPTP 7..155 CDD:319971 71/152 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5444
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4557
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm47992
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.