DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and CG14297

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_650756.1 Gene:CG14297 / 42260 FlyBaseID:FBgn0038655 Length:250 Species:Drosophila melanogaster


Alignment Length:146 Identity:51/146 - (34%)
Similarity:75/146 - (51%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKVLMICLGNICRSPIAEVVMVDTLEKANVKDVEVDSAAIGGWHVGNRADPRAISTLQKHGLKCT 67
            :|:|.:|:||.|.||:|||:|.:.:.|.::. .|||||.:..|:.|.|.:.|.:..|::|||:..
  Fly     4 KKILFVCMGNSCSSPMAEVIMQNLMVKTSLY-WEVDSAGLRTWNTGRRPNKRCLQILREHGLRSD 67

  Fly    68 HIVRQIRKQDFSEFDYIFGMDEDNMSELRRLAP---KGSKAELLMLGDFGLEKKNRIIEDPYYER 129
            |..||....||..|||:..|||....||...|.   .|...::|:|..||.......|:......
  Fly    68 HFCRQFTVNDFLYFDYVVAMDEAVFKELLLWAADNRAGKHCQVLLLSSFGKNGLPAFIDSLSPTH 132

  Fly   130 GAEGFETAYQQCVVAC 145
            ..:.|.:||.|....|
  Fly   133 KLKNFRSAYYQIKECC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 51/146 (35%)
CG14297NP_650756.1 LMWPc 4..152 CDD:238063 51/146 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446177
Domainoid 1 1.000 64 1.000 Domainoid score I560
eggNOG 1 0.900 - - E1_COG0394
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I416
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - P PTHR11717
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.