DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and RGD1565965

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_038956418.1 Gene:RGD1565965 / 302513 RGDID:1565965 Length:191 Species:Rattus norvegicus


Alignment Length:152 Identity:62/152 - (40%)
Similarity:89/152 - (58%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKVLMICLGNICRSPIAEVVMVDTLEKANVKD-VEVDSAAIGGWHVGNRADPRAISTLQKHGLKC 66
            :.:|.:||||||||||||.|....:...||.| ..:||.|...:.|||..|.|....::|||:..
  Rat     7 KSMLFVCLGNICRSPIAEAVFRKLVIDENVSDNWRIDSVATSTYEVGNPPDYRGQHCVKKHGIHM 71

  Fly    67 THIVRQIRKQDFSEFDYIFGMDEDNMSELRRLA--PKGSKAELLMLGDFGLEKKNRIIEDPYYER 129
            .||..||.::||:.|:||..|||.|:.:|.|.:  .|..:|:..:||.:. .:|..|||||||..
  Rat    72 QHIALQIAREDFATFNYILCMDESNLRDLNRKSNQVKNCRAKTELLGSYD-PQKQLIIEDPYYGN 135

  Fly   130 GAEGFETAYQQCVVACAAFMKE 151
            .:: ||...||.:..|.||:::
  Rat   136 DSD-FEVVNQQYLRCCKAFLEK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 62/149 (42%)
RGD1565965XP_038956418.1 LMWPTP 7..155 CDD:319971 62/149 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38274
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.