DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and Y94H6A.7

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_500246.5 Gene:Y94H6A.7 / 177055 WormBaseID:WBGene00022379 Length:164 Species:Caenorhabditis elegans


Alignment Length:153 Identity:73/153 - (47%)
Similarity:98/153 - (64%) Gaps:6/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKVLMICLGNICRSPIAEVVMVDTLEKANVKDV-EVDSAAIGGWHVGNRADPRAISTLQKHGLK- 65
            :.|||:||||||||||||.|.:|.|:|...::. .|||:||.|:|.|...|.||:..|:|:|:| 
 Worm     7 KSVLMVCLGNICRSPIAEAVFIDCLKKRGKREEWHVDSSAIIGYHTGKGPDSRAMGALKKYGIKD 71

  Fly    66 CTHIVRQIRKQDFSEFDYIFGMDEDNMSELRRLA---PKGS-KAELLMLGDFGLEKKNRIIEDPY 126
            ..|..|.....||.:||||||||:.|:.:|:.:|   ||.. |||:||||...:....|.:.|||
 Worm    72 YQHRARVTSPDDFRKFDYIFGMDDQNIEDLQEIARKVPKTERKAEILMLGVQDVMAGKREVPDPY 136

  Fly   127 YERGAEGFETAYQQCVVACAAFM 149
            ||.|::.|:...||||..|.||:
 Worm   137 YESGSKQFDEVLQQCVKCCDAFL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 73/153 (48%)
Y94H6A.7NP_500246.5 LMWPTP 7..160 CDD:319971 73/153 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167119
Domainoid 1 1.000 134 1.000 Domainoid score I3101
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38274
Inparanoid 1 1.050 135 1.000 Inparanoid score I3144
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62674
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm14557
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - LDO PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.