DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment primo-1 and Acp1

DIOPT Version :9

Sequence 1:NP_001027186.1 Gene:primo-1 / 3772179 FlyBaseID:FBgn0040077 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001103709.1 Gene:Acp1 / 11431 MGIID:87881 Length:158 Species:Mus musculus


Alignment Length:152 Identity:70/152 - (46%)
Similarity:96/152 - (63%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKVLMICLGNICRSPIAEVVMVDTLEKANVKD-VEVDSAAIGGWHVGNRADPRAISTLQKHGLKC 66
            :.||.:||||||||||||.|....:....|.| ..:||:|:..|:||...||||:|.|:.||:..
Mouse     7 KSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGIST 71

  Fly    67 THIVRQIRKQDFSEFDYIFGMDEDNMSELRRLA--PKGSKAELLMLGDFGLEKKNRIIEDPYYER 129
            .|..|||.|:||:.||||..|||.|:.:|.|.:  .|..||::.:||.:. .:|..|||||||..
Mouse    72 AHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYD-PQKQLIIEDPYYGN 135

  Fly   130 GAEGFETAYQQCVVACAAFMKE 151
            .:: ||..||||:..|.||:::
Mouse   136 DSD-FEVVYQQCLRCCKAFLEK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
primo-1NP_001027186.1 LMWPTP 3..150 CDD:319971 70/149 (47%)
Acp1NP_001103709.1 LMWPTP 7..155 CDD:319971 70/149 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5451
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38274
Inparanoid 1 1.050 126 1.000 Inparanoid score I4672
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62674
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm42877
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - LDO PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.