DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33892 and AT2G37470

DIOPT Version :9

Sequence 1:NP_001027325.1 Gene:His2B:CG33892 / 3772166 FlyBaseID:FBgn0053892 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_181283.1 Gene:AT2G37470 / 818324 AraportID:AT2G37470 Length:138 Species:Arabidopsis thaliana


Alignment Length:125 Identity:88/125 - (70%)
Similarity:106/125 - (84%) Gaps:7/125 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTSGKA-AKKAGKAQKNITK----TDKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSKAMSIMN 61
            |.:||| |:|..||:|.|:|    ::||||:.:|  |:|.|||:|||||||||.|||.|||.|||
plant    14 KPAGKAPAEKLPKAEKKISKDAGGSEKKKKKSKKSVETYKIYIFKVLKQVHPDVGISGKAMGIMN 78

  Fly    62 SFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121
            ||:|||||::|.|:|:||.|||:.|||||||||||||:|||||||||||||||||||:||
plant    79 SFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33892NP_001027325.1 H2B 33..121 CDD:197718 70/87 (80%)
AT2G37470NP_181283.1 H2B 49..138 CDD:197718 70/88 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1804
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1530
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm2531
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.