DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33892 and H2BS1

DIOPT Version :9

Sequence 1:NP_001027325.1 Gene:His2B:CG33892 / 3772166 FlyBaseID:FBgn0053892 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_059141.1 Gene:H2BS1 / 54145 HGNCID:4762 Length:126 Species:Homo sapiens


Alignment Length:128 Identity:101/128 - (78%)
Similarity:107/128 - (83%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAGKAQKNITKTDK----KKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            || |..|..|.||..|  |.:||..|    |:||.|||||::|:||||||||||||||||||.||
Human     1 MPEPAKSAPAPKKGSK--KAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIM 63

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||||||||.|||||.||||||||||||||||||||||||||||||||||||||||||:|
Human    64 NSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33892NP_001027325.1 H2B 33..121 CDD:197718 81/87 (93%)
H2BS1NP_059141.1 H2B 28..124 CDD:197718 86/95 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.