DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33892 and zgc:92591

DIOPT Version :9

Sequence 1:NP_001027325.1 Gene:His2B:CG33892 / 3772166 FlyBaseID:FBgn0053892 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001002724.1 Gene:zgc:92591 / 436997 ZFINID:ZDB-GENE-040718-483 Length:117 Species:Danio rerio


Alignment Length:118 Identity:97/118 - (82%)
Similarity:106/118 - (89%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFER 70
            |.:.|||.|||..:  |...|:|.||:|:||:|||||||||||||||||:|||||||||||:|||
Zfish     2 SNEGAKKKGKAPGD--KKGSKRKSKRRETYAVYIYKVLKQVHPDTGISSRAMSIMNSFVNDVFER 64

  Fly    71 IAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||.||||||||||||||||||:|||||||||||||||||||||||||||||||
Zfish    65 IATEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33892NP_001027325.1 H2B 33..121 CDD:197718 81/87 (93%)
zgc:92591NP_001002724.1 H2B 1..116 CDD:304987 94/115 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.