DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33892 and his-22

DIOPT Version :10

Sequence 1:NP_001027325.1 Gene:His2B:CG33892 / 3772166 FlyBaseID:FBgn0053892 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_505294.1 Gene:his-22 / 179266 WormBaseID:WBGene00001896 Length:123 Species:Caenorhabditis elegans


Alignment Length:147 Identity:28/147 - (19%)
Similarity:58/147 - (39%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLNGYLSTDFHIKSPAKKFF------QTCIETMDLPKDDVTVEIEEVPLEKKKTTFRIEGFQIS 59
            ::|..:|||.....|.|:..|      :...|:....:|.:.:..:.:.|:..|...|.:...::
 Worm   562 ISLKSFLSTSSDFISYAEDLFDFNTNTERSRESNFRRRDSIVISDQRLALDFAKEVVRRKSLLLA 626

  Fly    60 EWYKSFKGTITPDMATWQNPDGYKKLEGTMTITHVEDNDCDRAILTVKYEKINSDIKDPGTIMDT 124
            |.....:.::..|....:..||::.|.........:::....:|..|    :..|:|...|.|.:
 Worm   627 EPTCHTRSSLDIDELLTEVCDGFESLTSYKDTFSGQNSFVKESIHLV----LEKDLKGKKTEMTS 687

  Fly   125 FV-------EFFKEMDE 134
            .|       ||  ::||
 Worm   688 GVWDLGWRSEF--QIDE 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33892NP_001027325.1 HFD_H2B 33..120 CDD:467035 13/86 (15%)
his-22NP_505294.1 HFD_H2B 27..120 CDD:467035
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.