DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex6 and MSP1

DIOPT Version :9

Sequence 1:NP_001027403.2 Gene:Pex6 / 3772165 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_011542.3 Gene:MSP1 / 852915 SGDID:S000003260 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:106/327 - (32%)
Similarity:158/327 - (48%) Gaps:48/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 LGRTTLDMSHFAKNLTDMQSSFADSLGAPKVPKVYWSDIGGLAKLKDEIQSSIGLPL--KHVHLM 644
            |...|||.         .:.:...|:..|....:.:.|||||..|..::..|:..||  ..|:..
Yeast    64 LAEVTLDA---------YERTILSSIVTPDEINITFQDIGGLDPLISDLHESVIYPLMMPEVYSN 119

  Fly   645 GKNLRR-SGILLYGPPGTGKTLVAKAVATECNLSFLSVQGPELLNMYVGQSEQNVREVFSRARSA 708
            ...|:. ||:|||||||.|||::|||:|.|...:|:|::...:::.:.|:|.:.|..:||.|...
Yeast   120 SPLLQAPSGVLLYGPPGCGKTMLAKALAKESGANFISIRMSSIMDKWYGESNKIVDAMFSLANKL 184

  Fly   709 APCVLFLDELDSLAPNRGVAGDSGGVMDRVVSQLLAEMDGMSDGDTSK-PIFILAATNRPDLIDP 772
            .||::|:||:||....|      ......|.:.|.||...:.||..:. .:.|:.||||.:.||.
Yeast   185 QPCIIFIDEIDSFLRER------SSTDHEVTATLKAEFMTLWDGLLNNGRVMIIGATNRINDIDD 243

  Fly   773 ALLRPGRFDKLFYVG-PCSTAEDK-AAVLRAQTQRFALDAG-VDMEQIAERLKSEMSGADLYSIC 834
            |.||  |..|.|.|. |.|....| .:||...|:   ||.. .|::.||:..|. .||:||..:|
Yeast   244 AFLR--RLPKRFLVSLPGSDQRYKILSVLLKDTK---LDEDEFDLQLIADNTKG-FSGSDLKELC 302

  Fly   835 SNAWLSAV-------RRTIDGHLSGTI-----SEKELVPENVIVQEEDFTKSFNKFVPS-ISAKD 886
            ..|.|.|.       |:.||   ||||     |..::.|    ::.:||||.......| :|::.
Yeast   303 REAALDAAKEYIKQKRQLID---SGTIDVNDTSSLKIRP----LKTKDFTKKLRMDATSTLSSQP 360

  Fly   887 LE 888
            |:
Yeast   361 LD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 91/278 (33%)
P-loop_NTPase 367..492 CDD:304359
AAA 653..787 CDD:278434 50/134 (37%)
MSP1NP_011542.3 MDN1 <10..>164 CDD:227596 36/108 (33%)
RecA-like_ATAD1 92..255 CDD:410928 63/170 (37%)
AAA_lid_3 280..319 CDD:407720 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.