DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex6 and ATAD1

DIOPT Version :9

Sequence 1:NP_001027403.2 Gene:Pex6 / 3772165 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001308896.1 Gene:ATAD1 / 84896 HGNCID:25903 Length:361 Species:Homo sapiens


Alignment Length:323 Identity:101/323 - (31%)
Similarity:165/323 - (51%) Gaps:30/323 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   577 KIRNRLGRTTLDMSHFAKN--LTDMQSSFADSLGAPKVPKVYWSDIGGLAKLKDEIQSSIGLPLK 639
            |:..::|         .||  |::.:.|.|..|..|....|.||||.||..:..:::.::.||:|
Human    57 KLMKQIG---------VKNVKLSEYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIK 112

  Fly   640 HVHLMGKNLR----RSGILLYGPPGTGKTLVAKAVATECNLSFLSVQGPELLNMYVGQSEQNVRE 700
            ..||. :|.|    ..|:|||||||.||||:|||.|.|....|:::|...|.:.:.|:|::....
Human   113 KKHLF-ENSRLLQPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAA 176

  Fly   701 VFSRARSAAPCVLFLDELDSLAPNRGVAGDSGGVMDRVVSQLLAEMDGMSDGDTSKPIFILAATN 765
            |||.|....|.::|:||:||...||..:......|  :.:|.::..||: |.|.|..:.::.|||
Human   177 VFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATAM--MKAQFMSLWDGL-DTDHSCQVIVMGATN 238

  Fly   766 RPDLIDPALLRPGRFDKLFYVGPCSTAEDKAAVLRAQTQRFALDAGVDMEQIAERLKSEMSGADL 830
            ||..:|.|::|  |....|::.. ...:.:.|:|:...:...:|..||:.::|:.... .||:||
Human   239 RPQDLDSAIMR--RMPTRFHINQ-PALKQREAILKLILKNENVDRHVDLLEVAQETDG-FSGSDL 299

  Fly   831 YSICSNAWLSAVRRTIDGHLSGTISEKELVPENVIVQEEDFTKSFNKFVPSISAKDLEYFNNL 893
            ..:|.:|.|..||..::.....:..|.|:.|    ||::|..::..|...|   ||..:.|.|
Human   300 KEMCRDAALLCVREYVNSTSEESHDEDEIRP----VQQQDLHRAIEKMKKS---KDAAFQNVL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 89/275 (32%)
P-loop_NTPase 367..492 CDD:304359
AAA 653..787 CDD:278434 50/133 (38%)
ATAD1NP_001308896.1 RecA-like_ATAD1 92..257 CDD:410928 62/170 (36%)
AAA_lid_3 282..321 CDD:407720 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.