DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex6 and Spast

DIOPT Version :9

Sequence 1:NP_001027403.2 Gene:Pex6 / 3772165 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster
Sequence 2:XP_008762708.1 Gene:Spast / 362700 RGDID:1308494 Length:614 Species:Rattus norvegicus


Alignment Length:316 Identity:100/316 - (31%)
Similarity:156/316 - (49%) Gaps:45/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 KNLTDMQSSFADSLGAPKVPK---VYWSDIGGLAKLKDEIQSSIGLP-LKHVHLMGKNLRRSGIL 654
            ||..::.|:.|:.:....|..   |.:.||.|....|..:|..:.|| |:.....|......|:|
  Rat   313 KNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPSLRPELFTGLRAPARGLL 377

  Fly   655 LYGPPGTGKTLVAKAVATECNLSFLSVQGPELLNMYVGQSEQNVREVFSRARSAAPCVLFLDELD 719
            |:||||.|||::|||||.|.|.:|.::....|.:.|||:.|:.||.:|:.||...|.::|:||:|
  Rat   378 LFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVD 442

  Fly   720 SLAPNRGVAGDSGGVMD---RVVSQLLAEMDGM-SDGDTSKPIFILAATNRPDLIDPALLRPGRF 780
            ||...|     ..|..|   |:.::.|.|.||: |.||..  :.::.|||||..:|.|:||  ||
  Rat   443 SLLCER-----REGEHDASRRLKTEFLIEFDGVQSAGDDR--VLVMGATNRPQELDEAVLR--RF 498

  Fly   781 DKLFYVGPCSTAEDKAAVLRAQTQRFALDAGVDMEQIAE--RLKSEMSGADLYSICSNAWLSAVR 843
            .|..||   |...::..:|..:.......:.:..:::|:  |:....||:||.::..:|.|..:|
  Rat   499 IKRVYV---SLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIR 560

  Fly   844 RTIDGHLSGTISEKELVPENV---------IVQEEDFTKSFNKFVPSISAKDLEYF 890
                          ||.||.|         .::..|||:|..|...|:|.:.||.:
  Rat   561 --------------ELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAY 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 86/262 (33%)
P-loop_NTPase 367..492 CDD:304359
AAA 653..787 CDD:278434 58/137 (42%)
SpastXP_008762708.1 MIT_spastin 114..193 CDD:239142
P-loop_NTPase 339..>395 CDD:304359 23/55 (42%)
AAA 372..508 CDD:214640 61/147 (41%)
AAA 376..506 CDD:278434 59/141 (42%)
Vps4_C <578..610 CDD:286426 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.