DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33809 and his-73

DIOPT Version :10

Sequence 1:NP_001027294.1 Gene:His3:CG33809 / 3772163 FlyBaseID:FBgn0053809 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001366902.1 Gene:his-73 / 41657024 WormBaseID:WBGene00001947 Length:46 Species:Caenorhabditis elegans


Alignment Length:167 Identity:34/167 - (20%)
Similarity:59/167 - (35%) Gaps:48/167 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GAVDIISGSEIVPGPEEQG----YLQYRFTIMP-----APES--------RTQLLQISIDPEHAK 124
            |.|:||:..|::...::.|    .|..:..|.|     ..||        ..::|.::.|....|
 Worm   153 GTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEK 217

  Fly   125 --------CSICLNIWHDVVTAAPCLHNFCNGCFSEWMRRSEEKHKHVLCPQCRTTVQYVGKNHF 181
                    .::.|.|.:..|.|||  |.|.|.            :|:||.....|...:....: 
 Worm   218 FAAGVSMITALSLAISYPTVAAAP--HMFLNA------------YKNVLAVALATEYSFPQAEN- 267

  Fly   182 LKNIQEEILKVDAALRRPAED--------IAVLDSSA 210
            :|...::..|...|:..|...        :||.:.:|
 Worm   268 VKEFLKDPTKFAVAVAAPVSGESGGAVVAVAVEEEAA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33809NP_001027294.1 PTZ00018 1..136 CDD:185400 16/83 (19%)
his-73NP_001366902.1 HFD_SF <1..46 CDD:480273
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.