DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33809 and H3c4

DIOPT Version :10

Sequence 1:NP_001027294.1 Gene:His3:CG33809 / 3772163 FlyBaseID:FBgn0053809 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_835511.1 Gene:H3c4 / 319149 MGIID:2448322 Length:136 Species:Mus musculus


Alignment Length:86 Identity:18/86 - (20%)
Similarity:34/86 - (39%) Gaps:21/86 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KHEWCRITKNLGQSSATIHN-----------KSSDAILVDKAVVPKDGAVDIIS------GSEIV 88
            :|:|..:.|:..:|..|...           |:.|.:.:..:..||.|.|..::      |.|.:
Mouse   216 EHDWGEMWKDAPRSDDTSRRLAVCNMDWDRLKAKDLLALFNSFKPKGGVVLSVTVYPSEFGKERI 280

  Fly    89 PGPEEQGYLQYRFTIMPAPES 109
            ...:.||.|:    :...||:
Mouse   281 HAEQTQGPLE----LSSLPEN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33809NP_001027294.1 PTZ00018 1..136 CDD:185400 18/86 (21%)
H3c4NP_835511.1 PTZ00018 1..136 CDD:185400
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.