DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33809 and H3c7

DIOPT Version :10

Sequence 1:NP_001027294.1 Gene:His3:CG33809 / 3772163 FlyBaseID:FBgn0053809 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_038576.1 Gene:H3c7 / 260423 MGIID:2448329 Length:136 Species:Mus musculus


Alignment Length:42 Identity:11/42 - (26%)
Similarity:19/42 - (45%) Gaps:6/42 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 QGVSGPVCVRETFRPISERTITRIPFITHEMNRHEQDITQRC 343
            :|.:.|.|.....|.|.:|.:..:.  |:|:    ||.:..|
Mouse    23 KGAAIPTCCLSVLRRIPKRVLRSVR--TYEV----QDTSGHC 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33809NP_001027294.1 PTZ00018 1..136 CDD:185400
H3c7NP_038576.1 PTZ00018 1..136 CDD:185400 11/42 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.