DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33809 and his-25

DIOPT Version :10

Sequence 1:NP_001027294.1 Gene:His3:CG33809 / 3772163 FlyBaseID:FBgn0053809 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_496895.1 Gene:his-25 / 175031 WormBaseID:WBGene00001899 Length:136 Species:Caenorhabditis elegans


Alignment Length:97 Identity:23/97 - (23%)
Similarity:37/97 - (38%) Gaps:15/97 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TAAPCLHNFCNGCFSEWMRRSEE--KHK----------HVLCPQCRTTVQYVGKN--HFLKNIQE 187
            |.||.|..|.|....|.:...||  .:|          :.:|......|...|.|  |||...:.
 Worm   421 TMAPLLEMFPNLQTKEMLASEEELAPYKNFSSRMAAIDYTVCLHSEVFVTTQGGNFPHFLMGHRR 485

  Fly   188 EILKVDAALRRP-AEDIAVLDSSASIQSNLII 218
            .:....:...|| ...:|:|..:.:|..:|::
 Worm   486 YMFGGHSKTIRPDKRKLAILFDNPNIGYSLLL 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33809NP_001027294.1 PTZ00018 1..136 CDD:185400
his-25NP_496895.1 PTZ00018 1..136 CDD:185400
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.