DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33809 and zgc:162611

DIOPT Version :10

Sequence 1:NP_001027294.1 Gene:His3:CG33809 / 3772163 FlyBaseID:FBgn0053809 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001082986.2 Gene:zgc:162611 / 100037365 ZFINID:ZDB-GENE-070410-87 Length:556 Species:Danio rerio


Alignment Length:74 Identity:14/74 - (18%)
Similarity:27/74 - (36%) Gaps:23/74 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KSTGGKAPRKQ-----------LATKAARKSA------PATGGVKKPHRYRPGTVALREIRRYQK 57
            |..|||...|:           ::.:...:|:      |.:|.:.:.|....|..|..:.::.. 
Zfish   456 KEQGGKLTHKKFMDQLIEELCSVSEEVPEQSSIQVEHLPVSGALLESHTATTGRQACSQCKKQD- 519

  Fly    58 STELLIRKL 66
                 ||:|
Zfish   520 -----IRQL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33809NP_001027294.1 PTZ00018 1..136 CDD:185400 14/74 (19%)
zgc:162611NP_001082986.2 DDE_Tnp_1_7 98..452 CDD:433521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.