DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33850 and Hist1h2ah

DIOPT Version :9

Sequence 1:NP_001027361.1 Gene:His2A:CG33850 / 3772148 FlyBaseID:FBgn0053850 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001302421.1 Gene:Hist1h2ah / 502125 RGDID:1594367 Length:130 Species:Rattus norvegicus


Alignment Length:122 Identity:110/122 - (90%)
Similarity:116/122 - (95%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:||||||||||||||||||||||||:|||.||:||
  Rat     1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||
  Rat    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33850NP_001027361.1 PTZ00017 16..124 CDD:185399 98/106 (92%)
Hist1h2ahNP_001302421.1 PTZ00017 1..130 CDD:185399 110/122 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 14/20 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4453
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm9107
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X55
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.