DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33850 and H2AL3

DIOPT Version :10

Sequence 1:NP_001027361.1 Gene:His2A:CG33850 / 3772148 FlyBaseID:FBgn0053850 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001382484.1 Gene:H2AL3 / 115482686 HGNCID:53960 Length:148 Species:Homo sapiens


Alignment Length:97 Identity:35/97 - (36%)
Similarity:57/97 - (58%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            |:|.....:.:.:..|.|.||.|||||..:.|.||:..:|..:.:..||:||.|:|||.|.:||.
Human     1 MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEK 65

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLL 97
            .|...:::.:..|.|.|::.|::.||:|..:|
Human    66 VGKEVKNSCRLCITPEHVKRALQKDEQLRWIL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33850NP_001027361.1 PTZ00017 16..124 CDD:185399 33/82 (40%)
H2AL3NP_001382484.1 HFD_H2A 16..94 CDD:467020 31/77 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..128
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.