DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA86a and CheA75a

DIOPT Version :9

Sequence 1:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:191 Identity:62/191 - (32%)
Similarity:109/191 - (57%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKYTVLVLLIGIPKLL--LQAQMSYEAIFVSVTSEENSKPFD--------LSNLRLIGRERILNG 56
            :|:.|:::|:   :||  ::.:.|||      .:.|..:||:        ...|:.|||||.|||
  Fly     1 MKWLVIIVLL---QLLEKIKCEQSYE------VTNERLEPFEGDSQTLVLFDGLKTIGRERALNG 56

  Fly    57 TFEILEDLDDEHFQISVEIYTNPARDGNYKLLPMSVPRQGVCTFFKKYGFYF-RDCIKNGINTDL 120
            :|:.|.:::::.|::|||:|::|..||.:|.:.|.||:..:|..|||:...| :..:|.|..|:.
  Fly    57 SFKFLGEMNNDDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKFYVQFVQPSLKTGETTNF 121

  Fly   121 -FLNTTSCLFPKGHYYLKNVTINVQNWPKIMQRGLCRHIAFFYKNNVPMGSYNLTSSIEDR 180
             .::...|..|:|.:|:|||.:|.|:||..:.||:.:.|..|:.....:|...:...||||
  Fly   122 PVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKIEDR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 16/47 (34%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.