DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA86a and CheA84a

DIOPT Version :9

Sequence 1:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster


Alignment Length:181 Identity:77/181 - (42%)
Similarity:105/181 - (58%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YTVLVLLIG-----IPKLLLQAQMSYEAIFVSVTSEENSKPFDLSNLRLIGRERILNGTFEILED 63
            :.||::|||     ||:       :||..|:|:|| ..:..||.|.:|.:||||:.|||||:.||
  Fly     6 FCVLIMLIGKTCALIPR-------TYETRFISITS-NGTNLFDFSQIRFLGRERMANGTFELKED 62

  Fly    64 LDDEHFQISVEIYTNPARDGNYKLLPMSVPRQGVCTFFKKYGFYFRDCIKNGINTDLFLNTTSCL 128
            ||:|.|.:..|.:.:...||.||.||.:.|:|.|||..|.|..||...||.|:.||...:|..|.
  Fly    63 LDNESFSVVGETFIDSVGDGEYKQLPFTAPKQSVCTALKAYWSYFEPSIKYGVKTDFPAHTHPCP 127

  Fly   129 FPKGHYYLKNVTINVQNWPKIMQRGLCRHIAFFYKNNVPMGSYNLTSSIED 179
            .|||.||:|:|.:...|||.||.||..:.:|..:||:...||..:.|.|.|
  Fly   128 LPKGIYYIKDVVLKNDNWPVIMPRGYLKAVANLFKNDEYGGSLEIVSQISD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 20/47 (43%)
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2680
88.000

Return to query results.
Submit another query.