DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA86a and CheA29a

DIOPT Version :9

Sequence 1:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:54/158 - (34%)
Similarity:77/158 - (48%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FVSVTSEENSKP--FDLSNLRLIGRERILNGTFEILEDLDDEHFQISVEI--YTNPA-RDGNYKL 87
            |.|:...|..|.  |..| :||:||||:|||:.....||||. |.:.::|  :.|.. ..||.|:
  Fly    31 FESINGIEGEKETLFTCS-VRLVGRERMLNGSIMHQVDLDDS-FDVWMDILHFKNGEWAQGNIKV 93

  Fly    88 LPMSVPRQGVCTFFKKY-GFYFRDCIKNGINTDLFLNTTSCLFPKGHYYLKNVTINVQNWPKIMQ 151
                  |...|.:|..| |.||...:|   :::|......|:||||.|||:...|..||||.|:.
  Fly    94 ------RTKPCDWFTNYFGKYFLPLVK---DSNLPPIQEMCVFPKGEYYLRITKIEPQNWPPILY 149

  Fly   152 RGLCRHIAFFYKNNVPMGSYNLTSSIED 179
            |||.:....:.::....|.......:||
  Fly   150 RGLNQFNINYVRDGKSTGGIQFVIDLED 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 18/47 (38%)
CheA29aNP_788004.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.