DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14246 and Peritrophin-15b

DIOPT Version :10

Sequence 1:NP_652260.1 Gene:CG14246 / 3772140 FlyBaseID:FBgn0040608 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_524982.1 Gene:Peritrophin-15b / 50432 FlyBaseID:FBgn0040958 Length:93 Species:Drosophila melanogaster


Alignment Length:82 Identity:31/82 - (37%)
Similarity:34/82 - (41%) Gaps:21/82 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DYNGEPGC--RSAEELGQSYRHFWDPTAYWQCGGKSMEEERERDRDWERERPAQLQRCPANELFY 67
            |.||||.|  ||    |:..|.|||||.||||.....               |:|..|..|..|.
  Fly    25 DGNGEPDCVGRS----GEISRDFWDPTHYWQCSSTGQ---------------AELVACEQNTGFD 70

  Fly    68 DRERRCVKWKHWQWTEP 84
            .:...||.|..|||..|
  Fly    71 PKTGSCVDWSVWQWYPP 87

Return to query results.
Submit another query.