DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33859 and RAT5

DIOPT Version :10

Sequence 1:NP_001027376.1 Gene:His2A:CG33859 / 3772139 FlyBaseID:FBgn0053859 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_200275.1 Gene:RAT5 / 835553 AraportID:AT5G54640 Length:130 Species:Arabidopsis thaliana


Alignment Length:122 Identity:94/122 - (77%)
Similarity:104/122 - (85%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK---GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 62
            |:||||   .|..| ||.|||.:||||||||||.|.|:.|.||||||||||||||||:|||||||
plant     1 MAGRGKTLGSGGAK-KATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEV 64

  Fly    63 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119
            ||||||||||||||||:|||:|||:||||||:|||..||||.|||:|||..:|||||
plant    65 LELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33859NP_001027376.1 PTZ00017 16..124 CDD:185399 85/104 (82%)
RAT5NP_200275.1 PLN00157 1..130 CDD:177758 94/122 (77%)

Return to query results.
Submit another query.