DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33859 and H2az1

DIOPT Version :9

Sequence 1:NP_001027376.1 Gene:His2A:CG33859 / 3772139 FlyBaseID:FBgn0053859 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_073165.1 Gene:H2az1 / 58940 RGDID:621464 Length:128 Species:Rattus norvegicus


Alignment Length:128 Identity:79/128 - (61%)
Similarity:93/128 - (72%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAK----SRSDRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAA 60
            |:| ||.||..||||    |||.|||||||||||||.|:....:. ||||.|.||.||::|||.|
  Rat     1 MAG-GKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTA 64

  Fly    61 EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            |||||||||::|.|..||.|||||||||.||||:.|:. .|||.|||:|:|...|:.||.::|
  Rat    65 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33859NP_001027376.1 H2A 16..121 CDD:197711 68/105 (65%)
H2A 16..119 CDD:238029 66/103 (64%)
H2az1NP_073165.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 14/24 (58%)
Required for interaction with INCENP. /evidence=ECO:0000250 1..17 10/16 (63%)
PLN00154 6..121 CDD:177756 72/115 (63%)
M6 cassette. /evidence=ECO:0000250 89..100 8/10 (80%)
Required for interaction with INCENP. /evidence=ECO:0000250 93..103 5/10 (50%)
Required for interaction with PWWP2A. /evidence=ECO:0000250|UniProtKB:P0C0S5 120..128 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.