DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33859 and Macroh2a1

DIOPT Version :10

Sequence 1:NP_001027376.1 Gene:His2A:CG33859 / 3772139 FlyBaseID:FBgn0053859 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_006253635.1 Gene:Macroh2a1 / 29384 RGDID:621462 Length:372 Species:Rattus norvegicus


Alignment Length:123 Identity:79/123 - (64%)
Similarity:93/123 - (75%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            ||.|  |||.|....|||.:||:.|||||:.|.::||:...|:|.|||||:|||:|||.||:|||
  Rat     1 MSSR--GGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILEL 63

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            ||||||||||.|:.|||:.||:.||||||:||.|||||.|||||||...||.||...|
  Rat    64 AGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33859NP_001027376.1 PTZ00017 16..124 CDD:185399 72/108 (67%)
Macroh2a1XP_006253635.1 H2A 14..119 CDD:197711 71/104 (68%)
Macro_H2A-like 178..368 CDD:394875
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.