DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33859 and h2ax2

DIOPT Version :9

Sequence 1:NP_001027376.1 Gene:His2A:CG33859 / 3772139 FlyBaseID:FBgn0053859 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001373300.1 Gene:h2ax2 / 100001004 ZFINID:ZDB-GENE-160113-112 Length:127 Species:Danio rerio


Alignment Length:125 Identity:112/125 - (89%)
Similarity:118/125 - (94%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||.||||||||||:||||||||||||||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||.|
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33859NP_001027376.1 H2A 16..121 CDD:197711 96/104 (92%)
H2A 16..119 CDD:238029 94/102 (92%)
h2ax2NP_001373300.1 PTZ00017 1..127 CDD:185399 112/125 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4548
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111318
Inparanoid 1 1.050 223 1.000 Inparanoid score I3500
OMA 1 1.010 - - QHG53554
OrthoDB 1 1.010 - - D607367at33208
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm6415
orthoMCL 1 0.900 - - OOG6_100077
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.