DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG33873 and his-46

DIOPT Version :10

Sequence 1:NP_001027372.1 Gene:His4:CG33873 / 3772113 FlyBaseID:FBgn0053873 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_502133.1 Gene:his-46 / 178050 WormBaseID:WBGene00001920 Length:103 Species:Caenorhabditis elegans


Alignment Length:34 Identity:9/34 - (26%)
Similarity:20/34 - (58%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AKHEEKEGIPVEQQRLIFQGRVLEDSKAIS-DYN 128
            ||..:.|.|.::||.:|:...::..:.::: .||
 Worm   369 AKKHQSEKISIKQQVVIWWAGLMRGAVSMALAYN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG33873NP_001027372.1 PLN00035 1..103 CDD:177669 2/6 (33%)
his-46NP_502133.1 PLN00035 1..103 CDD:177669
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.