DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33919

DIOPT Version :9

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:216 Identity:66/216 - (30%)
Similarity:104/216 - (48%) Gaps:41/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VSCVYLGVLLCLPNTIFYSNGYFFKIRKTECIANGAYFSNVSCILKPVNWTRSVLNMDGDIKEAL 72
            :.|.::|.   |.||     ...:|::|.||:.|....|||||.:|.:||..:|:|||..:...|
  Fly     9 LGCCFIGQ---LTNT-----QLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPL 65

  Fly    73 TDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAI---SHLTEWTNVNHSCPY 134
            .:..:.::||.||.||.||||.|..|..:|::::.:   ||: .|.:   .....:||||||||:
  Fly    66 HNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERR---NFI-PYGVIMWKLFKRYTNVNHSCPF 126

  Fly   135 RVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGI--HLG 197
                                   .||||||:..||...||..|...|:::...:..|...  ::|
  Fly   127 -----------------------SGHLIARDGFLDTSLLPPFPQGFYQVSLVVTDTNSTSTDYVG 168

  Fly   198 LVLIYFEILEDYYKQKKNKPL 218
            .:..:.:.:| :.|.||...|
  Fly   169 TMKFFLQAME-HIKSKKTHNL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 35/103 (34%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014288
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.