DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33770

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:211 Identity:42/211 - (19%)
Similarity:76/211 - (36%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MAK--WLAVSCVYLGVLLCLPNTIFYSNGYFFKIR---KTECIA-----NGAYFSNVSCILKPVN 56
            ||:  |:: ....|.:.|||...:       |.||   ..:.||     |..||.|.:..::   
  Fly     1 MARPIWIS-QLARLEIPLCLAIAL-------FSIRAEGSVKFIAGESRFNRKYFENFTFTIR--- 54

  Fly    57 WTRSVLNMDGDIKEALT-------DIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFL 114
              ...:.:|..:::.|.       |.:..|    .:|.:....|:.  ..|||.:: |..:.|..
  Fly    55 --NDKIFLDMYLRKPLVRGWRARLDFRTRV----GNSKSFQSLFST--SIDVCNIV-NAAKINLF 110

  Fly   115 QKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDE-VSLPILPI 178
            :|: ..:|.::.|....||...|                      |...|:::..| :..|.:..
  Fly   111 KKW-YKNLLKYGNFLRQCPLNAS----------------------HYYLRDWQFGEGLVPPFITS 152

  Fly   179 QDYKI-AFNFSGANPG 193
            ..|:: .:||.|...|
  Fly   153 GSYRLETYNFFGKYKG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 18/101 (18%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 21/107 (20%)

Return to query results.
Submit another query.