DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33688

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:203 Identity:51/203 - (25%)
Similarity:82/203 - (40%) Gaps:47/203 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYLGVLLCLPNTIFYSNGYFFKIRKTECIANGA---YFSNVSCILKPVNWTRSVL----NMDGDI 68
            :.||.|..:.|.:.::|        .:|...|.   ||.  .|.:|.||.|...:    |:...:
  Fly     9 IILGYLATVFNHVTFTN--------LKCGIRGEKIYYFE--KCFIKAVNRTHKYIDIYVNLHQQV 63

  Fly    69 KEALTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCP 133
            ...:|.||:      ...:|.||||.|....|||:.||:..||...:.|.|  ....:|:||:||
  Fly    64 VNNVTVIKL------MRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDI--YKNNSNINHTCP 120

  Fly   134 YRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVS-LPILPIQDYKIAFNFSGANPGIHLG 197
            |:..:.::                  ||...|...|.:. ||::. .||.|...:|..|  :...
  Fly   121 YKDVVIVH------------------HLWTGNLESDFMKYLPLID-GDYAIYTEWSVYN--VARA 164

  Fly   198 LVLIYFEI 205
            .:.:|..:
  Fly   165 FIDVYIRV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 29/101 (29%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 29/106 (27%)

Return to query results.
Submit another query.