DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33643

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:58 Identity:18/58 - (31%)
Similarity:22/58 - (37%) Gaps:19/58 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NGYFFKI---RKTECIANGAY---------------FSNVSCILKP-VNWTRSVLNMD 65
            ||...|:   |...|:..|:.               ||||.|.||. .|:|...|.||
  Fly    81 NGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNVECPLKANFNYTMKNLYMD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 18/58 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.