DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33641

DIOPT Version :9

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:141 Identity:31/141 - (21%)
Similarity:65/141 - (46%) Gaps:28/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FSNVSCILKPVNWTRSVLNMDGDIKEALTDIKM-SVEVFYK-DSSNLYKPFAVKFKFDVCQLLKN 107
            |..:.|.|...| .||.:|::..:|:.::|:.: ::..|:| ::.|..|.:.|  :.|.|.:|:.
  Fly    41 FEKMDCNLYQAN-NRSYVNVEMKLKKEVSDLNVRAIMEFWKPNAQNKMKLYDV--RVDGCLILRT 102

  Fly   108 KTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVS 172
             ...|.|..:.:....:.:||..|||::.:        |:..::             ::.|||..
  Fly   103 -IHKNKLFYFYVKSFKKHSNVVLSCPFKAN--------FTYKMD-------------DWFLDEEE 145

  Fly   173 L-PILPIQDYK 182
            | |..|:..::
  Fly   146 LPPFAPVGQFR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 22/103 (21%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.