DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33631

DIOPT Version :9

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:131 Identity:30/131 - (22%)
Similarity:54/131 - (41%) Gaps:44/131 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LNMDGDIK--EAL-----TDIKMSVEVFYKD--SSNLYKPFAVKFK-----------------FD 100
            :|:.||.:  :||     |.:|.::.:..::  .|| :..|.:|.:                 .|
  Fly    45 INIFGDSRFMKALSYIDETRLKFTIFISLREELGSN-FLTFNIKIRVRPTGRTNFVTLLQMRDLD 108

  Fly   101 VC----QLLKNKTQSNFLQ-KYAISHLTEWTNVNHSCPYRV-SLCIYNI-VK--FSQYIEY-IYM 155
            :|    :..||.....||| :..:|.:.       .||.|| :..:.|: ||  :.|.::. ||.
  Fly   109 LCGFFTEFRKNPMMKYFLQSEMQLSDII-------VCPVRVGNYSVKNVSVKDIYPQVLQNGIYK 166

  Fly   156 F 156
            |
  Fly   167 F 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 23/104 (22%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.