DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33137

DIOPT Version :9

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:92/204 - (45%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNTIFYSNGYFFKIRKTECIANGAYFSNVSCILKPVNWTRSVLNMDGDIKEALTDIKMSVEVFYK 84
            ||.:       :|::..||.....:.:|.||.::.:||.::|..||..:...|.:|.:..::..|
  Fly    10 PNIV-------YKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKK 67

  Fly    85 DSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHL---TEWTNVNHSCPYRVSLCIYNIVKF 146
            |.||.::||.|....::|..|..:   :|: .|.:..|   ..::|.|||||||           
  Fly    68 DYSNKFQPFLVDVVINMCDALSRR---SFI-PYGLIILKIARTFSNFNHSCPYR----------- 117

  Fly   147 SQYIEYIYMFLKGHLIARNFRLDEVSLP-ILPIQDYKIAFNFSGAN-----PGIHLGLVLIYFEI 205
                        |||:||...|:|..|| :.|:..||  ||.:...     |..|:|.::.|.:.
  Fly   118 ------------GHLMARGAYLNESYLPNVFPLGFYK--FNITIMENYITPPSAHVGGIIWYVQA 168

  Fly   206 LEDYYKQKK 214
            :.....:||
  Fly   169 MHAIQPKKK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 31/104 (30%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014288
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.