DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33137

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:92/204 - (45%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNTIFYSNGYFFKIRKTECIANGAYFSNVSCILKPVNWTRSVLNMDGDIKEALTDIKMSVEVFYK 84
            ||.:       :|::..||.....:.:|.||.::.:||.::|..||..:...|.:|.:..::..|
  Fly    10 PNIV-------YKLKNIECSTVPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKK 67

  Fly    85 DSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHL---TEWTNVNHSCPYRVSLCIYNIVKF 146
            |.||.::||.|....::|..|..:   :|: .|.:..|   ..::|.|||||||           
  Fly    68 DYSNKFQPFLVDVVINMCDALSRR---SFI-PYGLIILKIARTFSNFNHSCPYR----------- 117

  Fly   147 SQYIEYIYMFLKGHLIARNFRLDEVSLP-ILPIQDYKIAFNFSGAN-----PGIHLGLVLIYFEI 205
                        |||:||...|:|..|| :.|:..||  ||.:...     |..|:|.::.|.:.
  Fly   118 ------------GHLMARGAYLNESYLPNVFPLGFYK--FNITIMENYITPPSAHVGGIIWYVQA 168

  Fly   206 LEDYYKQKK 214
            :.....:||
  Fly   169 MHAIQPKKK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 31/104 (30%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 33/119 (28%)

Return to query results.
Submit another query.