DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG13193

DIOPT Version :9

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:163 Identity:34/163 - (20%)
Similarity:67/163 - (41%) Gaps:38/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ECIANGAYFSNVSCILKPVNW--TRSVLNMDGDIKEALTD-IKMSVEVFYK-DSSNLYKPFAVKF 97
            ||..:  |.|::.      .|  .:..||:|..:...|.: ::.::.:... |..:.|:.. ..:
  Fly    43 ECSKD--YCSSIR------GWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQTL-FSY 98

  Fly    98 KFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLI 162
            ..|.|:.|:...||: |.|..:.::.::.|:...||  :....|::                   
  Fly    99 DMDTCKTLRELLQSS-LMKVWLRNVFKYGNLADRCP--IQPASYDV------------------- 141

  Fly   163 ARNFRLDEVSLP-ILPIQDYKI-AFNFSGANPG 193
             |||:|:..|:| .||...|:: ..|:.|...|
  Fly   142 -RNFQLENHSIPGYLPAGFYRLHDTNYYGKPKG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 22/102 (22%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.