DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG13193

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:163 Identity:34/163 - (20%)
Similarity:67/163 - (41%) Gaps:38/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ECIANGAYFSNVSCILKPVNW--TRSVLNMDGDIKEALTD-IKMSVEVFYK-DSSNLYKPFAVKF 97
            ||..:  |.|::.      .|  .:..||:|..:...|.: ::.::.:... |..:.|:.. ..:
  Fly    43 ECSKD--YCSSIR------GWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQTL-FSY 98

  Fly    98 KFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLI 162
            ..|.|:.|:...||: |.|..:.::.::.|:...||  :....|::                   
  Fly    99 DMDTCKTLRELLQSS-LMKVWLRNVFKYGNLADRCP--IQPASYDV------------------- 141

  Fly   163 ARNFRLDEVSLP-ILPIQDYKI-AFNFSGANPG 193
             |||:|:..|:| .||...|:: ..|:.|...|
  Fly   142 -RNFQLENHSIPGYLPAGFYRLHDTNYYGKPKG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 22/102 (22%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 24/107 (22%)

Return to query results.
Submit another query.