DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33467

DIOPT Version :9

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:218 Identity:62/218 - (28%)
Similarity:100/218 - (45%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLA-VSCVYLGVLLCLPNTIFYSNGYFFKIRKTECIANGAYFSNVSCILKPVNWTRSVLNMDGDI 68
            ||. :|..::|.:.        .:...:|..|.||..|.|...||||.:||:||..:::|:|..:
  Fly     5 WLVLLSICFIGHMT--------DSQLVYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLDCYL 61

  Fly    69 KEALTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAI---SHLTEWTNVNH 130
            ...|.:..:.|:||.||.||.||||.:...|.:|.:::.|   ||| .||:   .....:|||. 
  Fly    62 IYPLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERK---NFL-PYAVMVWELFQRFTNVK- 121

  Fly   131 SCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGIH 195
            ||                       .:.|.|.|||..|:...:|..|...|:|:..||.:|....
  Fly   122 SC-----------------------HISGQLSARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNR 163

  Fly   196 --LGLVLIYFEILEDYYKQKKNK 216
              :|:|..:.:.:::...:|:.|
  Fly   164 EFVGIVKFFVQAMDEIKIKKRPK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 31/103 (30%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014288
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.