DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33476

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:54 Identity:15/54 - (27%)
Similarity:19/54 - (35%) Gaps:25/54 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEVFYK--DSSNLY--------KPFAVKF---------------KFDVCQLLKN 107
            ||.|:|  |..::|        |.|.:.|               .||.||.|.|
  Fly    33 VEYFHKAPDMVDIYTFRVVKLAKAFTIDFAVRVVKTKRVMYKVDNFDGCQFLMN 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 13/51 (25%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 8/30 (27%)

Return to query results.
Submit another query.