powered by:
Protein Alignment CG33792 and CG33476
DIOPT Version :9
Sequence 1: | NP_001027411.2 |
Gene: | CG33792 / 3772111 |
FlyBaseID: | FBgn0053792 |
Length: | 225 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_995798.2 |
Gene: | CG33476 / 2768727 |
FlyBaseID: | FBgn0053476 |
Length: | 165 |
Species: | Drosophila melanogaster |
Alignment Length: | 54 |
Identity: | 15/54 - (27%) |
Similarity: | 19/54 - (35%) |
Gaps: | 25/54 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 VEVFYK--DSSNLY--------KPFAVKF---------------KFDVCQLLKN 107
||.|:| |..::| |.|.:.| .||.||.|.|
Fly 33 VEYFHKAPDMVDIYTFRVVKLAKAFTIDFAVRVVKTKRVMYKVDNFDGCQFLMN 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.