DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33792 and CG33477

DIOPT Version :10

Sequence 1:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:96 Identity:28/96 - (29%)
Similarity:42/96 - (43%) Gaps:28/96 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FYSNGYFFKI----RKTECIANGAYFSNVSCILKPVNWTRSVLNMDGDIKEALTDI------KMS 78
            |.:|...||:    .|| .:.||:||   .|.:||..:   .|..|| |...:..:      ::|
  Fly   116 FLNNPVIFKMFGESYKT-LVVNGSYF---KCPIKPNVY---YLKTDG-IMSMIPSVHPFGRFQLS 172

  Fly    79 VEVFYKDSSNLYKPFAVKFKFDVCQLLKNKT 109
            :.|..|:|.   |||       |.::|.|.|
  Fly   173 MRVKMKESR---KPF-------VMEMLLNYT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 9/28 (32%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 17/62 (27%)

Return to query results.
Submit another query.