DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meltrin and mde10

DIOPT Version :9

Sequence 1:NP_001027575.1 Gene:Meltrin / 3772109 FlyBaseID:FBgn0265140 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_593472.1 Gene:mde10 / 2542178 PomBaseID:SPAC17A5.04c Length:512 Species:Schizosaccharomyces pombe


Alignment Length:244 Identity:85/244 - (34%)
Similarity:121/244 - (49%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 PNPAMVATTMAHEMGHNFGMEHDTSDCHCRDEK---CVMAAS--------------STSFIPVNW 440
            ||..:|   :|||:||..|:.||.:...|.|..   |.:::|              |.::..:.:
pombe   221 PNDRLV---VAHEIGHILGLIHDCNKKSCGDHSEACCPLSSSLCDAQELYIMNPSNSYTYANLRF 282

  Fly   441 SSCSIDQL-TIAFSRGMNYCLRNKP--ERLFESPTCGNGFVEPGEQCDCGLPEHCE-NACCNAQT 501
            |.|||.|| ::...:.::....:||  :.:....|||||.||.||:||||  |.|| |.||:.:|
pombe   283 SDCSILQLHSLVEKKYVSLSCLS
KPSEKSVLRLGTCGNGIVEDGEECDCG--EDCENNPCCDGKT 345

  Fly   502 CMLHSKNATCATGE--CCDLTTCRPKLAGSACREAENECDLPEYCTGESEYCPADVFRRDTEPCD 564
            |.| :|.:.|...:  ||  ..|..|.||:.||::.|.||.||:|||.|..||.|....|...|.
pombe   346 CKL-TKGSLCDDQQDACC--YQCHFKNAGTLCRQSTNPCDKPEFCTGISSKCPVD
ENWDDGRICQ 407

  Fly   565 G--GQAYCFHGTCRSHSNQCRTLWGPTGDNSEHCYN-------KNTEGT 604
            .  |...|..|.|.|.|.||:.|   |..:|..|::       :|.:||
pombe   408 DSLGMGSCASGVCTSASRQCKKL---TNFSSLSCHSDSCKVSCQNEDGT 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MeltrinNP_001027575.1 Pep_M12B_propep 64..174 CDD:279848
Reprolysin 269..464 CDD:279729 22/88 (25%)
ZnMc_adamalysin_II_like 269..462 CDD:239797 22/86 (26%)
Disintegrin 479..555 CDD:278623 37/78 (47%)
ACR 558..701 CDD:214743 17/56 (30%)
mde10NP_593472.1 ZnMc 65..305 CDD:294052 22/86 (26%)
Disintegrin 324..397 CDD:278623 37/77 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000154
OrthoInspector 1 1.000 - - otm47294
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11905
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4147
SonicParanoid 1 1.000 - - X50
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.