DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meltrin and tag-275

DIOPT Version :9

Sequence 1:NP_001027575.1 Gene:Meltrin / 3772109 FlyBaseID:FBgn0265140 Length:1407 Species:Drosophila melanogaster
Sequence 2:NP_509031.2 Gene:tag-275 / 180886 WormBaseID:WBGene00016423 Length:472 Species:Caenorhabditis elegans


Alignment Length:315 Identity:79/315 - (25%)
Similarity:121/315 - (38%) Gaps:103/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DYEKADGDNGLGGGIPSLPLRLDGGEFSRTLLRKRRQADDSSQLIRGPYNANKYSSYVELVIVVD 277
            ||..|..|:|.             ..|.|:|:                :..||.::|.|..::  
 Worm    39 DYSLASTDSGT-------------TVFIRSLV----------------FVDNKTTAYYEFDMI-- 72

  Fly   278 NKVYKNFQENTKKVHQYCKGIANIINALYVPLNIFVALVGVVIWNESNEIEFSSDGDLTLRNFLN 342
             :|..|..:...:.:||       :|.|.|.|    .:||::..|.         |||:|::|..
 Worm    73 -RVKLNIMKMVDEANQY-------LNQLGVGL----IVVGILQTNR---------GDLSLQSFHE 116

  Fly   343 YRSTKLVLDH--PNDNAQLLTKENFAGGVVGKALKGPICTYEYSGGVSMQHS-------PN-PAM 397
            ||:::|   |  |:.....|....:|||:.            |..|:...||       || |..
 Worm   117 YRNSRL---HKLPDHEFATLISYKYAGGLA------------YVNGMCSSHSVSLSGFYPNEPRA 166

  Fly   398 VATTMAHEMGHNFGMEHD-------TSDCHC------RDEKCVMAASSTSFIPVNWSSCSIDQLT 449
            :.:...||:.|..|:.|.       ..:|.|      :::.|:.       ||.....|::.|..
 Worm   167 MGSIFFHEVAHLVGVPHRAVNESIYVPNCLCTPKDSLKEDGCLK-------IPGFDHDCTVQQFV 224

  Fly   450 IAFSRGMNYCLRNKPERLFE--SPTCGNGFVEPGEQCDCGLPEHCENACCNAQTC 502
            ....:  |.|:...|  :||  .|.||||.:|.||.||||||..|.:..|...||
 Worm   225 NTIYK--NKCILKHP--IFEQSEPVCGNGVLENGEDCDCGLPGRCSDLNCQPHTC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MeltrinNP_001027575.1 Pep_M12B_propep 64..174 CDD:279848
Reprolysin 269..464 CDD:279729 48/217 (22%)
ZnMc_adamalysin_II_like 269..462 CDD:239797 48/215 (22%)
Disintegrin 479..555 CDD:278623 13/24 (54%)
ACR 558..701 CDD:214743
tag-275NP_509031.2 ZnMc 57..234 CDD:381785 50/239 (21%)
Disintegrin 252..>277 CDD:385688 13/24 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.