DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meltrin and LOC105946911

DIOPT Version :9

Sequence 1:NP_001027575.1 Gene:Meltrin / 3772109 FlyBaseID:FBgn0265140 Length:1407 Species:Drosophila melanogaster
Sequence 2:XP_031754005.1 Gene:LOC105946911 / 105946911 -ID:- Length:233 Species:Xenopus tropicalis


Alignment Length:259 Identity:90/259 - (34%)
Similarity:131/259 - (50%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 YCLRNKPERLFESP---------TCGNGFVEPGEQCDCGLPEHCENACCNAQTCMLHSKNATCAT 513
            :.|..:|..|.:.|         .|||...|.||:||||..:.|::.||:|.||.| ...|.||.
 Frog     4 FLLNTQPSSLGDVPDKTNFLRPNVCGNKLTEVGEECDCGTVQECKDQCCDAATCKL-KPGAQCAE 67

  Fly   514 GECCDLTTCRPKLAGSACREA-ENECDLPEYCTGESEYCPADVFRRDTEPCDGGQAYCFHGTCRS 577
            ||||  :.|:.|.||..|||. :::|||.:.|.|:|.:||:|.|:.:..||..|:.||::|||.:
 Frog    68 GECC--SNCKIKAAGEVCRERNDDDCDLEDVCDGKSPWCPSDRFQANGAPCGKGEGYCYNGTCPT 130

  Fly   578 HSNQCRTLWGPTGDNS----EHCYNKNTEGTRLGNCGYNRLNKTFLRCEEQHVNCGMLHCIHLNE 638
            ...||.:||   |||:    :.|:|||.|||..|:|  ..:..|::.|:.::|.||:|:|...||
 Frog   131 MQRQCTSLW---GDNTLVGEDLCFNKNMEGTDYGHC--KNVGSTYIPCKPENVMCGVLYCNSDNE 190

  Fly   639 ------RLEFGMESAAVLSHSYISHDRKIVACRTALVDLGLQTTDPGLTPNGAKCGVDKMCVDQ 696
                  |:....|..|:|:                         ..|:..||.|||..|..|.:
 Frog   191 YPTVPGRVAVTGECKALLA-------------------------PEGMVQNGIKCGDGKASVHE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MeltrinNP_001027575.1 Pep_M12B_propep 64..174 CDD:279848
Reprolysin 269..464 CDD:279729 1/5 (20%)
ZnMc_adamalysin_II_like 269..462 CDD:239797 1/3 (33%)
Disintegrin 479..555 CDD:278623 36/76 (47%)
ACR 558..701 CDD:214743 45/149 (30%)
LOC105946911XP_031754005.1 Disintegrin 34..107 CDD:395147 36/75 (48%)
ACR 111..224 CDD:214743 43/142 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.