DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meltrin and LOC101882358

DIOPT Version :9

Sequence 1:NP_001027575.1 Gene:Meltrin / 3772109 FlyBaseID:FBgn0265140 Length:1407 Species:Drosophila melanogaster
Sequence 2:XP_005174526.3 Gene:LOC101882358 / 101882358 -ID:- Length:136 Species:Danio rerio


Alignment Length:143 Identity:50/143 - (34%)
Similarity:67/143 - (46%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 LRCEEQHVNCGMLHCIHLNERLEFGMESAAVLSHSYISHDRKIVACRTALV--------DLGLQT 675
            ::||:....||.:.| |...:...|..:.::  .:.|..|...|.||...|        ||    
Zfish     1 MKCEKSDAKCGKIQC-HSAAKKPKGTNAVSI--DTTIQTDGIEVKCRGTFVYSTQDGQGDL---- 58

  Fly   676 TDPGLTPNGAKCGVDKMCVDQRCLPVDAVRQKGMGKPCPEDCNGNGICNSRGHCHCDVGFGGESC 740
            .||||...|.|||..|:|.|:||........:.    |...|:|:|:|||.|:|||..|:....|
Zfish    59 PDPGLVMTGTKCGEGKVCKDRRCQNTSFTELES----CIVRCHGHGVCNSNGNCHCSRGWAPPFC 119

  Fly   741 SKAGSGGSPDSGP 753
            .|.|.|||.||||
Zfish   120 EKPGLGGSVDSGP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MeltrinNP_001027575.1 Pep_M12B_propep 64..174 CDD:279848
Reprolysin 269..464 CDD:279729
ZnMc_adamalysin_II_like 269..462 CDD:239797
Disintegrin 479..555 CDD:278623
ACR 558..701 CDD:214743 28/89 (31%)
LOC101882358XP_005174526.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D162519at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.