DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33798 and CG13250

DIOPT Version :10

Sequence 1:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:168 Identity:31/168 - (18%)
Similarity:62/168 - (36%) Gaps:44/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLVEITN---FECESLDR-----NFSDFEYCRLKSVNRTYKYISLK--VHLFQTPVNQIKVNTAI 73
            |:::.|.   |:|:.::.     ||.:......:||.:.:..:|:.  .:....||.|       
  Fly    41 SVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQQ------- 98

  Fly    74 YKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSAESIN 138
                      |:.:.||||..|:.::.:.:...:......:.|...:||.          ..::|
  Fly    99 ----------LFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPL----------LANVN 143

  Fly   139 FQITKILPFPE--GKYMVKMNW-----FAYDINRAIIR 169
            :..|:....|:  ..||..|.:     |....|..:||
  Fly   144 YTSTRFALNPDHFPAYMPDMKFNTKLVFQLSRNMGLIR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 13/86 (15%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/112 (18%)

Return to query results.
Submit another query.